SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g11776

Feature Type:gene_model
Chromosome:Gm04
Start:10379077
stop:10379556
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g11776
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G51040AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF339 (InterPro:IPR005631); Has 532 Blast hits to 532 proteins in 207 species: Archae - 0; Bacteria - 285; Metazoa - 16; Fungi - 41; Plants - 40; Viruses - 0; Other Eukaryotes - 150 (source: NCBI BLink). | chr5:20750700-20751790 FORWARD LENGTH=188 SoyBaseE_val: 1.00E-17ISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0080022GO-bp Annotation by Michelle Graham. GO Biological Process: primary root development SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0008177GO-mf Annotation by Michelle Graham. GO Molecular Function: succinate dehydrogenase (ubiquinone) activity SoyBaseN/AISS
PTHR12469Panther FAMILY NOT NAMED JGI ISS
PTHR12469:SF1Panther gb def: hypothetical orf, yol071wp [saccharomyces cerevisiae] JGI ISS
PF03937PFAM Protein of unknown function (DUF339) JGI ISS
UniRef100_G7J2S2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Succinate dehydrogenase assembly factor n=1 Tax=Medicago truncatula RepID=G7J2S2_MEDTR SoyBaseE_val: 5.00E-28ISS
UniRef100_I1JXS4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JXS4_SOYBN SoyBaseE_val: 4.00E-49ISS

Expression Patterns of Glyma04g11776
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g11776 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g105700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g11776
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g11776
>Glyma04g11776.1   sequence type=CDS   gene model=Glyma04g11776   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAGTTTCAGAAATGCTGCAATCAATGTCTTCAGAGTGATCAATTCCAAAAAAGCCACCATCACTGCTTTCACAAACCCCCTTCACACTCTCAGGTTTACCCCTTTCTCGTCCCACACTCAAAATCAAGCCCTGGAAATCGATTTATCTAACGAAGAAAGCAAAAGACATTTGTTTAACCAGCTATTATATAGAAGCAAACAACGAGGGTTCCTGGAACTGGATTTGGTCCTCGGAAAATGGGTTGAGGCCGGACAACATTCACTCCTTGGATGA
Predicted protein sequences of Glyma04g11776
>Glyma04g11776.1   sequence type=predicted peptide   gene model=Glyma04g11776   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASFRNAAINVFRVINSKKATITAFTNPLHTLRFTPFSSHTQNQALEIDLSNEESKRHLFNQLLYRSKQRGFLELDLVLGKWVEAGQHSLLG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo