SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g37300

Feature Type:gene_model
Chromosome:Gm05
Start:40906001
stop:40909022
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g37300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11220AT Annotation by Michelle Graham. TAIR10: VIRB2-interacting protein 2 | chr4:6838176-6839578 REVERSE LENGTH=271 SoyBaseE_val: 3.00E-115ISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0071786GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum tubular network organization SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005789GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0071458GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to cytosolic side of endoplasmic reticulum membrane SoyBaseN/AISS
GO:0071782GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum tubular network SoyBaseN/AISS
KOG1792 KOG Reticulon JGI ISS
PTHR10994Panther RETICULON/NOGO JGI ISS
PTHR10994:SF27Panther RETICULON-RELATED (PLANT) JGI ISS
PF02453PFAM Reticulon JGI ISS
UniRef100_B3TLN1UniRef Annotation by Michelle Graham. Most informative UniRef hit: 24 kDa seed maturation protein n=1 Tax=Elaeis guineensis RepID=B3TLN1_ELAGV SoyBaseE_val: 3.00E-124ISS
UniRef100_UPI00001AB8D0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00001AB8D0 related cluster n=1 Tax=unknown RepID=UPI00001AB8D0 SoyBaseE_val: 0ISS

Expression Patterns of Glyma05g37300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g37300
ParalogEvidenceComments
Glyma08g02250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g37300 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g212800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g37300
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g37300
>Glyma05g37300.1   sequence type=CDS   gene model=Glyma05g37300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAGCATCACGAACACGAGGAAGTGAAGGGTGAGTCCTTGTTGGAGAAGATTTCTGGGAAGATCCACGACCACGATTCCTCGTCTTCGTCGGATTCCGACAACGACAAAACCAGCGCCACTGATTCCTTCAAGTCTAATGTTTTCAGGCTTTTCGGCAGAGAAAAGCCCATTCATCATGTTCTTGGCGGTGGAAAACCGGCTGATGTTTTTCTATGGAGAAACAAGAAGATATCCGCATCGACACTCGGAGTTGCGACCGCTATATGGGTTCTGTTTGAATTGCTTGAGTACCACCTCCTGACTTTGGTTTGCCACTTCCTGATCCTTGCTCTGGCGGGGTTGTTCTTGTGGTCCAATGCATCCACTTTCATCAACAAGAGTCCACCAAAGATCCCACAAGTGCACATTCCAGAGGAACCTGTTTTAAAATTTGCCTCTGCTCTTAGAATTGAGATCAATCGGGCTTTTGCGGTGTTAAGGGATATTGCTTCTGGAAGGGATCTCAAGAAGTTCTTATCAGTGATTGCTGGATTATGGGTTTTCTCTATTCTGGGTTGTTGGGCCAACTTCTTGACCTTGTTCTACATAGCTTTTGTTTTGCTTCACACTGTGCCTGTGCTTTATGAGAAATATGAAGATCATGTCGACTCTTTTGGTGAGAAAGCAATTGCCGAGATTAAGAAGCAATATGCAGTGTTTGATGCGAAGGTATTGAGCAAGATACCCAGAGGACCTCTGAAAGATAAAAAGAAAGATTGA
Predicted protein sequences of Glyma05g37300
>Glyma05g37300.1   sequence type=predicted peptide   gene model=Glyma05g37300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEHHEHEEVKGESLLEKISGKIHDHDSSSSSDSDNDKTSATDSFKSNVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSILGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSKIPRGPLKDKKKD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo