SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g08270

Feature Type:gene_model
Chromosome:Gm06
Start:6072700
stop:6074973
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g08270
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G24390AT Annotation by Michelle Graham. TAIR10: AIG2-like (avirulence induced gene) family protein | chr2:10373796-10374654 FORWARD LENGTH=152 SoyBaseE_val: 4.00E-60ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06094PFAM AIG2-like family JGI ISS
UniRef100_B4FVZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: AIG2-like protein n=1 Tax=Zea mays RepID=B4FVZ7_MAIZE SoyBaseE_val: 1.00E-70ISS
UniRef100_C6T4K7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4K7_SOYBN SoyBaseE_val: 1.00E-126ISS

Expression Patterns of Glyma06g08270
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g08270
ParalogEvidenceComments
Glyma04g08210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g08270 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g078600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g08270
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g08270
>Glyma06g08270.1   sequence type=CDS   gene model=Glyma06g08270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCGTGAAGGTGAATTGCGTGGGTGGCGACACTCATAACGTCTTCGTGTACGGTAGTCTGTTAGCTGATGAAGTTGTCCATACCCTATTGAAGCGCGTCCCTCCAACCGCACCTGCCATCCTTCACGACTATCACAGGTTTAAGATCAAAGGTCGCGTTTATCCCGCTATTCTCCCTGTCCAGAATAACAAAGTTTATGGCAGGGTGCTTCTTGGTATCTCCGGAGTAGAACTAGATATTTTAGATGAATTTGAGGATGTTGAATATACTAGAACTGATGTTGAGGTTTCCTTGAAGGACAAGTCTGAAAAGTTACAAGTTTGCGCTTATGTTTGGAGCAACCCAAATGATCCTAACTTATATGCAGAGTGGAATTTTGAGGAATGGAAACAAGTTCACATGAATGATTTCGTCAAGATGACTGATGGCTTTAGGCAAGAGTTGGAGTTACCAGAATCAAAGCCAAGAGTGCAGACTTATGAAACCTTCTACAAGCAAGAAAACGATAAGCCACTTGAACCTTGA
Predicted protein sequences of Glyma06g08270
>Glyma06g08270.1   sequence type=predicted peptide   gene model=Glyma06g08270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSVKVNCVGGDTHNVFVYGSLLADEVVHTLLKRVPPTAPAILHDYHRFKIKGRVYPAILPVQNNKVYGRVLLGISGVELDILDEFEDVEYTRTDVEVSLKDKSEKLQVCAYVWSNPNDPNLYAEWNFEEWKQVHMNDFVKMTDGFRQELELPESKPRVQTYETFYKQENDKPLEP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo