SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g34961

Feature Type:gene_model
Chromosome:Gm11
Start:36700048
stop:36700906
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g34961
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G07310AT Annotation by Michelle Graham. TAIR10: Calcium-dependent lipid-binding (CaLB domain) family protein | chr1:2247775-2248833 REVERSE LENGTH=352 SoyBaseE_val: 3.00E-33ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR22949Panther WHITE COLLAR 2 PROTEIN (WC2) JGI ISS
PF00168PFAM C2 domain JGI ISS
UniRef100_B9SLI7UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9SLI7_RICCO SoyBaseE_val: 1.00E-81ISS
UniRef100_G7JB59UniRef Annotation by Michelle Graham. Most informative UniRef hit: BAHD acyltransferase DCR n=1 Tax=Medicago truncatula RepID=G7JB59_MEDTR SoyBaseE_val: 1.00E-57ISS

Expression Patterns of Glyma11g34961
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g34961
ParalogEvidenceComments
Glyma18g03390 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g34961 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g227500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g34961
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g34961
>Glyma11g34961.1   sequence type=CDS   gene model=Glyma11g34961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCATCTCGTCCCCCTCCTTCGAAATCCGTGGATCTGGACCTAACAATCGTGTCGGCGAAGCACCTGAAGAACGTGAACTGGAAGAACGGCGATCTGAAACCCTATGTGGTTTTCTGGGTGGACCCCGAGCGGCGCCTGGCCACGAAATCCGACGACTCCGGCAACACCTCCCCCGTCTGGAACGAGCGTTTCGCCCTCCCTCTCCCTCTCCCCCTCCACGACTCCTTCCTCACGCTCGAGATCTTCCACTCCAAACCCTCCGACACCCCCAAACCCCTCGTCGCCAACCTCCGCCTCCCCCTCAAAGACCTCCACGACTCAACTCGCTCCCGCAAAGGATACACCCCTTCCCATTCCCCTTCTCCACCAGCCTCTCCTTACACATCATACACCTCTTACACTGACTCCTATTCTAATTACTACCCCGCTTACTATTCTGGCGCTCCTCCCCCTCCCCCCCCTAGACCCTTCTTCGACCGTTACGCTGGGCCCAGTGGGCCTTCTGCTCCGCTTGATTACTCCTCCACTTATGACCCCATGCCCAAGCCTCCCAAAATGGGCCTCGGCGCTGGCCTCGCCATTGGCGCTGTTGCTGGGGCTCTCGGCGGGCTTGCTCTCGACGAGGGCCTTAACTACGAAGAGGACAAGATCGCCGAGAGGGTCGAGAACGACGTCGCTGCTGCTGCGCGCGACGATTACAGCGATTACCGAGTGGATTATTGA
Predicted protein sequences of Glyma11g34961
>Glyma11g34961.1   sequence type=predicted peptide   gene model=Glyma11g34961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSRPPPSKSVDLDLTIVSAKHLKNVNWKNGDLKPYVVFWVDPERRLATKSDDSGNTSPVWNERFALPLPLPLHDSFLTLEIFHSKPSDTPKPLVANLRLPLKDLHDSTRSRKGYTPSHSPSPPASPYTSYTSYTDSYSNYYPAYYSGAPPPPPPRPFFDRYAGPSGPSAPLDYSSTYDPMPKPPKMGLGAGLAIGAVAGALGGLALDEGLNYEEDKIAERVENDVAAAARDDYSDYRVDY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo