Glyma13g24140 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g24140

Feature Type:	gene_model
Chromosome:	Gm13
Start:	27468017
stop:	27470736
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g24140

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G45970	AT	Annotation by Michelle Graham. TAIR10: RAC-like 2 \| chr5:18643761-18645758 FORWARD LENGTH=201	SoyBase	E_val: 4.00E-118	ISS
GO:0007015	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament organization	SoyBase	N/A	ISS
GO:0007264	GO-bp	Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction	SoyBase	N/A	ISS
GO:0009832	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis	SoyBase	N/A	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005525	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTP binding	SoyBase	N/A	ISS
KOG0393	KOG	Ras-related small GTPase, Rho type	JGI		ISS
PTHR24072	Panther	FAMILY NOT NAMED	JGI		ISS
PF00071	PFAM	Ras family	JGI		ISS
UniRef100_I1M047	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M047_SOYBN	SoyBase	E_val: 1.00E-142	ISS
UniRef100_Q5EGL1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Small GTP-binding protein ROP1 n=1 Tax=Vigna radiata RepID=Q5EGL1_VIGRA	SoyBase	E_val: 3.00E-126	ISS

Expression Patterns of Glyma13g24140

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g24140

Paralog	Evidence	Comments
Glyma07g32440	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g24140 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g172600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g24140

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g24140

Limit To All Plant Sequences

>Glyma13g24140.1   sequence type=CDS   gene model=Glyma13g24140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTACGGCAAGGTTTATCAAGTGTGTAACAGTTGGAGATGGTGCTGTGGGAAAGACATGCATGCTTATATCCTATACCAGCAATACCTTTCCCACGGATTATGTTCCAACAGTGTTTGACAATTTCAGTGCTAATGTAACGGTGGATGGTAGTACTGTTAATCTTGGTTTATGGGACACTGCAGGACAAGAAGATTACAACAGGCTAAGGCCTTTAAGCTATAGAGGAGCTGATGTGTTTTTGTTGTGCTATTCTCTCATCAGCAAAGCCAGTTATGAGAACATCTCCAAAAAGTGGATACCTGAGCTAAGACATTATGCTCCAAATGTGCCTATAGTGCTGGTGGGAACAAAACTAGATTTGCGAGATAACAAGCAATTTCTGATTGATCATCCGGGATCCGCACGAATAACAACTGCTCAGGGTGAAGAATTGAAGAAAATGATTGGTGCAGTCACTTATATTGAGTGCAGCTCCAAAACACAGCTGAATGTGAAGACAGTTTTTGATGCTGCAATAAAGGTTGCATTGAAGCCACCAAAGCCAAAGAAGAAACCACGCAAGAAAAGGACCTGTACTTTCCTCTGA

Predicted protein sequences of Glyma13g24140

Limit To All Plant Sequences

>Glyma13g24140.1   sequence type=predicted peptide   gene model=Glyma13g24140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVTVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLCYSLISKASYENISKKWIPELRHYAPNVPIVLVGTKLDLRDNKQFLIDHPGSARITTAQGEELKKMIGAVTYIECSSKTQLNVKTVFDAAIKVALKPPKPKKKPRKKRTCTFL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain