Glyma13g38975 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g38975

Feature Type:	gene_model
Chromosome:	Gm13
Start:	39688331
stop:	39688917
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g38975

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_I2FFU6	UniRef	Annotation by Michelle Graham. Best UniRef hit: CLAVATA3 protein n=1 Tax=Lotus japonicus RepID=I2FFU6_LOTJA	SoyBase	E_val: 3.00E-23	ISS
UniRef100_I2FFU6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: CLAVATA3 protein n=1 Tax=Lotus japonicus RepID=I2FFU6_LOTJA	SoyBase	E_val: 3.00E-23	ISS

Expression Patterns of Glyma13g38975

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g38975

Paralog	Evidence	Comments
Glyma12g31336	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g38975 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g313400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g38975

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g38975

Limit To All Plant Sequences

>Glyma13g38975.1   sequence type=CDS   gene model=Glyma13g38975   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCAAAGTTTATCTTTACCACGGTGGTTTTAGTTATGCTTTTGTGCTTGCTTCTTATGAGGGACCCTTCTGGTTGTGGTTCTGCATATGAATGCTTTGGTGCTAATGCAGCTGGTCTTACGGACATTCCAAACAGGAAGGTGCTGCCTGTTTTGAAGGATAAGAAAACTAGTGCTCTGAAGGCTAGTCTGCGAGGATCATCAAGCAACAAGTATGGTGAAAAGCCACTGAATTGGGAGTTAAGGAAGGTTCCTTCAGGTCCAGATCCGCTGCATCATAACGGTGTGAACCCCAAAAATCCTCAAACCCCTTAA

Predicted protein sequences of Glyma13g38975

Limit To All Plant Sequences

>Glyma13g38975.1   sequence type=predicted peptide   gene model=Glyma13g38975   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKFIFTTVVLVMLLCLLLMRDPSGCGSAYECFGANAAGLTDIPNRKVLPVLKDKKTSALKASLRGSSSNKYGEKPLNWELRKVPSGPDPLHHNGVNPKNPQTP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain