Glyma16g28605 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g28605

Feature Type:	gene_model
Chromosome:	Gm16
Start:	32516966
stop:	32518687
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g28605

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G21310	AT	Annotation by Michelle Graham. TAIR10: extensin 3 \| chr1:7453693-7454988 REVERSE LENGTH=431	SoyBase	E_val: 3.00E-14	ISS
GO:0009664	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization	SoyBase	N/A	ISS
GO:0009735	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus	SoyBase	N/A	ISS
GO:0043161	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0043248	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome assembly	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0005199	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of cell wall	SoyBase	N/A	ISS
PF04554	PFAM	Extensin-like region	JGI		ISS
UniRef100_D8QY50	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Selaginella moellendorffii RepID=D8QY50_SELML	SoyBase	E_val: 2.00E-37	ISS
UniRef100_Q8LK15	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Extensin n=1 Tax=Brassica napus RepID=Q8LK15_BRANA	SoyBase	E_val: 3.00E-21	ISS

Expression Patterns of Glyma16g28605

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g28605 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g170100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g28605

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g28605

Limit To All Plant Sequences

>Glyma16g28605.1   sequence type=CDS   gene model=Glyma16g28605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTCTCTAATGGCCTCTCTTACTCTCACTCTTGTATTGGCAATAGTTTCTCTAAGCTTGTCATCTCAAGCCTCAGCTGACAAGTACGACTATTCATCTCCACCACCACCAGTTTACAAGTACAAGTCCCCACCACCACCCTACAAGTATTCATCTCCTCCACCACCTCCTAAGAAGCCTTACAAATACCCATCACCACCACCACCAGTTTACAAATACAAGTCACCACCACCACCCTACAAGTACCCTTCTCCTCCACCACCACCTAAAAAGCCCTACAAATACCCATCACCCCCACCTCCAGTTTACAAATACAAGTCACCACCACCACCAGTTTACAAGTACAAGTCCCCACCACCACCACCTAAGAAGCCCTACAAATACCCATCACCACCACCACCAGTTTACAAATACAAGTCACCACCCCCACCCTACAAGTACCCTTCTCCTCCACCACCTCCTAAGAAACCCTACAAATACCCATCTCCTCCACCCCCAGTATACAAGTACAAGTCCCCTCCTCCTCCATACAAGTACTCTTCTCCTCCACCTCCACCATACAAGTACCCTTCTCCACCACCCCCAGCTTACTACTACAAGTCACCTCCACCACCACCTAAGAAACCATACAAGTATCCATCTCCACCTCCTCCACACTATGTCTATGCATCACCACCTCCCCCATACCACTACTAG

Predicted protein sequences of Glyma16g28605

Limit To All Plant Sequences

>Glyma16g28605.1   sequence type=predicted peptide   gene model=Glyma16g28605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSLMASLTLTLVLAIVSLSLSSQASADKYDYSSPPPPVYKYKSPPPPYKYSSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPKKPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYSSPPPPPYKYPSPPPPAYYYKSPPPPPKKPYKYPSPPPPHYVYASPPPPYHY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain