SoyBase NEW SoyBase for review!
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.09g120100

Feature Type:gene_model
Chromosome:Gm09
Start:28741635
stop:28743594
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57000.1AT nucleolar essential protein-related JGI N/AIEA
GO:0000462GO-bp maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) EnsemblGenomesN/AIEA
GO:0070475GO-bp rRNA base methylation EnsemblGenomesN/AIEA
GO:0005730GO-cc nucleolus EnsemblGenomesN/AIEA
GO:0032040GO-cc small-subunit processome EnsemblGenomesN/AIEA
GO:0008168GO-mf methyltransferase activity EnsemblGenomesN/AIEA
GO:0008168GO-mf methyltransferase activity JGI N/AIEA
GO:0019843GO-mf rRNA binding EnsemblGenomesN/AIEA
GO:0070037GO-mf rRNA (pseudouridine) methyltransferase activity EnsemblGenomesN/AIEA
PTHR12636Panther NEP1/MRA1 JGI N/AIEA
PTHR12636:SF2Panther JGI N/AIEA
PF03587PFAM EMG1/NEP1 methyltransferase JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.09g120100 not represented in the dataset

Glyma.09g120100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma09g21291 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.09g120100.1 sequence-type=CDS polypeptide=Glyma.09g120100.1.p locus=Glyma.09g120100 ID=Glyma.09g120100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTAGGGGCAATATACGTTAAAATGGATCAACGAGGAGTGTTTGAAGTCAAACCACATGTTCGTATACCAAGAACGTGTAATCGATTCTGTGGTGTCATAATTCTTCTTCGTGTTGTTGAGGAACCTATAACACGCCATTTGCCTGTCAACTCTCACATAGTAGGTCTCTCTTATACTTCAGAAAAGTTGGTTGACATAGAGGAATATGTCTCAGTTTGGAGCAATGATTTGAGTCCTGTTTTTGTGGTAGGCACAATGGTGAATGGGAAAGTAAAAGGGGACTATATGCATGATTATATTTCAATTTCTGAATATCCACTTGCTGCTAAATACTGCCTAGGAATGATATGTGAAGCTTTGTAG

>Glyma.09g120100.1.p sequence-type=predicted peptide transcript=Glyma.09g120100.1 locus=Glyma.09g120100 ID=Glyma.09g120100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVGAIYVKMDQRGVFEVKPHVRIPRTCNRFCGVIILLRVVEEPITRHLPVNSHIVGLSYTSEKLVDIEEYVSVWSNDLSPVFVVGTMVNGKVKGDYMHDYISISEYPLAAKYCLGMICEAL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo