SoyBase NEW SoyBase for review!
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.16g150700

Feature Type:gene_model
Chromosome:Gm16
Start:31109999
stop:31114963
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G65480.1AT PEBP (phosphatidylethanolamine-binding protein) family protein JGI N/AIEA
GO:0009909GO-bp regulation of flower development EnsemblGenomesN/AIEA
GO:0048573GO-bp photoperiodism, flowering EnsemblGenomesN/AIEA
GO:0008429GO-mf phosphatidylethanolamine binding EnsemblGenomesN/AIEA
KOG3346 KOG Phosphatidylethanolamine binding protein JGI N/AIEA
PTHR11362Panther PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN JGI N/AIEA
PF01161PFAM Phosphatidylethanolamine-binding protein JGI N/AIEA

LocusGene SymbolProtein Name
E9 E9-1 E9 gene 1
FT2a Flowering locus T gene 2a
FTL3 Flowering locus T-like gene 3
FT2A phosphatidylethanolamine-binding protein FT2a
FT2a (E9) Flowering Locus T gene 2a
FT2a Flowering Locus T2 gene a

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma16g26660 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.16g150700.1 sequence-type=CDS polypeptide=Glyma.16g150700.1.p locus=Glyma.16g150700 ID=Glyma.16g150700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCCTAGTGGAAGTAGGGATCCTCTCGTTGTTGGGGGAGTAATTGGGGATGTATTGGATCCTTTTGAATATTCTATTCCTATGAGGGTTACCTACAATAACAGAGATGTCAGCAATGGATGTGAATTCAAACCCTCACAAGTTGTCAACCAACCAAGGGTAAATATCGGTGGTGATGACCTCAGGAACTTCTATACTTTGATTGCGGTTGATCCCGATGCACCTAGCCCAAGTGACCCCAATTTGAGAGAATACCTCCATTGGTTGGTGACTGATATCCCAGCAACAACAGGGGCTAGTTTCGGCCATGAGGTTGTAACATATGAAAGTCCAAGACCAATGATGGGGATTCATCGTTTGGTGTTTGTGTTATTTCGTCAACTGGGTAGGGAGACCGTGTATGCACCAGGATGGCGCCAGAATTTCAACACTAAAGAATTTGCTGAACTTTACAACCTTGGATTGCCAGTTGCTGCTGTCTATTTCAACATTCAGAGGGAATCTGGTTCTGGTGGAAGGAGGTTATACTAA

>Glyma.16g150700.1.p sequence-type=predicted peptide transcript=Glyma.16g150700.1 locus=Glyma.16g150700 ID=Glyma.16g150700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MPSGSRDPLVVGGVIGDVLDPFEYSIPMRVTYNNRDVSNGCEFKPSQVVNQPRVNIGGDDLRNFYTLIAVDPDAPSPSDPNLREYLHWLVTDIPATTGASFGHEVVTYESPRPMMGIHRLVFVLFRQLGRETVYAPGWRQNFNTKEFAELYNLGLPVAAVYFNIQRESGSGGRRLY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo