SoyBase NEW SoyBase for review!
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g36711

Feature Type:gene_model
Chromosome:Gm01
Start:49159188
stop:49159524
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g36711
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17705AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: cultured cell; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G08330.1); Has 135 Blast hits to 135 proteins in 32 species: Archae - 5; Bacteria - 29; Metazoa - 0; Fungi - 0; Plants - 91; Viruses - 0; Other Eukaryotes - 10 (source: NCBI BLink). | chr2:7692506-7692889 FORWARD LENGTH=127 SoyBaseE_val: 2.00E-41ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T2D5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T2D5_SOYBN SoyBaseE_val: 8.00E-52ISS
UniRef100_D7L9H5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein-methionine-s-oxide reductase n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7L9H5_ARALL SoyBaseE_val: 2.00E-38ISS

Expression Patterns of Glyma01g36711
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g36711 not represented in the dataset
Glyma01g36711 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g36711
ParalogEvidenceComments
Glyma11g08590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g36711 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g162300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g36711
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g36711
>Glyma01g36711.1   sequence type=CDS   gene model=Glyma01g36711   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCGTGTACAGCTGTACGGACTGCGGCTCCAACCTGAATTTGAACTCCGTTTATGCGTACCCTCCGGACTTCTACATCGAAGCCGGCAACAAGGGCTCCGTCTCCTTCTCCGCCGTCGACGCCACCAAGTTCAAATTCGACAAGGAGGACAAGATTCGTCCCTTCTTCGAAACCGTCAACTACTGGGGAATCCAGAGGAAGAGGACCAAGATCAACCAAGTCATCCCCAGAGCGCCCCGATATAGGTTCAAGACCAAAACCCTCAGAATCACTTCAACTTGA
Predicted protein sequences of Glyma01g36711
>Glyma01g36711.1   sequence type=predicted peptide   gene model=Glyma01g36711   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASVYSCTDCGSNLNLNSVYAYPPDFYIEAGNKGSVSFSAVDATKFKFDKEDKIRPFFETVNYWGIQRKRTKINQVIPRAPRYRFKTKTLRITST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo