SoyBase NEW SoyBase for review!
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g01590

Feature Type:gene_model
Chromosome:Gm02
Start:1124343
stop:1125600
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10530AT Annotation by Michelle Graham. TAIR10: Concanavalin A-like lectin protein kinase family protein | chr5:3324978-3326933 REVERSE LENGTH=651 SoyBaseE_val: 5.00E-26ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PF00139PFAM Legume lectin domain JGI ISS
UniRef100_P05046UniRef Annotation by Michelle Graham. Best UniRef hit: Lectin n=3 Tax=Glycine max RepID=LEC_SOYBN SoyBaseE_val: 0ISS
UniRef100_P05046UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lectin n=3 Tax=Glycine max RepID=LEC_SOYBN SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
Le1-1 Lectin 1 gene 1

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g01620 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g012600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g01590.1   sequence type=CDS   gene model=Glyma02g01590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACTTCAAAGTTGAAAACCCAGAATGTGGTTGTATCTCTCTCCCTAACCTTAACCTTGGTACTGGTGCTACTGACCAGCAAGGCAAACTCAGCGGAAACTGTTTCTTTCAGCTGGAACAAGTTCGTGCCGAAGCAACCAAACATGATCCTCCAAGGAGACGCTATTGTGACCTCCTCGGGAAAGTTACAACTCAATAAGGTTGACGAAAACGGCACCCCAAAACCCTCGTCTCTTGGTCGCGCCCTCTACTCCACCCCCATCCACATTTGGGACAAAGAAACCGGTAGCGTTGCCAGCTTCGCCGCTTCCTTCAACTTCACCTTCTATGCCCCTGACACAAAAAGGCTTGCAGATGGGCTTGCCTTCTTTCTCGCACCAATTGACACTAAGCCACAAACACATGCAGGTTATCTTGGTCTTTTCAACGAAAACGAGTCTGGTGATCAAGTCGTCGCTGTTGAGTTTGACACTTTCCGGAACTCTTGGGATCCACCAAATCCACACATCGGAATTAACGTCAATTCTATCAGATCCATCAAAACGACGTCTTGGGATTTGGCCAACAATAAAGTAGCCAAGGTTCTCATTACCTATGATGCCTCCACCAGCCTCTTGGTTGCTTCTTTGGTCTACCCTTCACAGAGAACCAGCAATATCCTCTCCGATGTGGTCGATTTGAAGACTTCTCTTCCCGAGTGGGTGAGGATAGGGTTCTCTGCTGCCACGGGACTCGACATACCTGGGGAATCGCATGACGTGCTTTCTTGGTCTTTTGCTTCCAATTTGCCACACGCTAGCAGTAACATTGATCCTTTGGATCTTACAAGCTTTGTGTTGCATGAGGCCATCTAA

>Glyma02g01590.1   sequence type=predicted peptide   gene model=Glyma02g01590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATSKLKTQNVVVSLSLTLTLVLVLLTSKANSAETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPHASSNIDPLDLTSFVLHEAI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo