SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma03g09050

Feature Type:gene_model
Chromosome:Gm03
Start:10373779
stop:10375240
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09020AT Annotation by Michelle Graham. TAIR10: alpha 1,4-glycosyltransferase family protein | chr3:2753307-2754542 FORWARD LENGTH=411 SoyBaseE_val: 2.00E-90ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0045088GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of innate immune response SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0008378GO-mf Annotation by Michelle Graham. GO Molecular Function: galactosyltransferase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
PTHR12042Panther LACTOSYLCERAMIDE 4-ALPHA-GALACTOSYLTRANSFERASE (ALPHA- 1,4-GALACTOSYLTRANSFERASE) JGI ISS
PF04488PFAM Glycosyltransferase sugar-binding region containing DXD motif JGI ISS
PF04572PFAM Alpha 1,4-glycosyltransferase conserved region JGI ISS
UniRef100_G7KRB0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lactosylceramide 4-alpha-galactosyltransferase n=1 Tax=Medicago truncatula RepID=G7KRB0_MEDTR SoyBaseE_val: 6.00E-125ISS
UniRef100_I1JLI3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JLI3_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g09050.2   sequence type=CDS   gene model=Glyma03g09050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCTGCATAAGTTCTTTCCAATTGCAACTCTCACCAGACACAATAATCCAAAAGTTGTTTGTTCATCGGCTGCTTAAACATGCCAAGTTATCTGTCTTCCCTCTAATCACTTTCTCTGCCATAATTTTTCTTATCTATGCTGATAGTATTATCTACCATGATTCATTACACTCAGCAACTAATAAAGAAGCTACAGAGAAGTTGGAAGTTCACAATCACAGAACAAAAGAAGAAATAAGGTCAACACTTGTTCTCATACCTTTACATTCCATTCGAGAGAAGGATGAAGCTGATAGTCAAAAACAGAAGGCTCTAGTCACCCCATTAAATGTCACAGAAGAAGAAAGACAAACATGTTTATTTGGAGGGAGAGAATTGCTTCCTGTGGAAAGCATTTTCAAGAACCATCCTAAGGCATGTCTGACAATTCTATCAAGAACTTTGGACACCAAGCATGGCTACAGGATCCTGAAACCACTGCTTGATCGTAGGTTCAAAGTGCAGGCAATGGCCCCAGACTTGCCATTTTTGGTCAAGGGGACTCCGGTCGAAGCTTGGTTTCGTGAGCTAAGGAAGGGTAGAAAGGACCCCAGTGAGATTCCTTTGTCTCAGAATCTATCTAATCTGATAAGACTTGCAGTTCTGTACAAATATGGTGGTGTCTACATAGATACATACTTTATACTTTATAGTAAGCACTGGACTAGATTAAATAATGCAGTTCTGATTTTTGATATTGGACATCCACTTCGGCACAGATTCATCAATGAATTTGCCTTGACTTTCAATGGAAACAAATGGGGGAATAATGGTCCCTACCTGGTTTCCAGAGTGATTAAGAGGCTGTTTAAAAGACATGATTTCAACTTTACAATCTTGCCGCCTATGGCCTTTTATCCAGTGGATTGGAACAAGATAAAATCAAGACGGGTAGAAGCCAACCTGCTTCAGCTCAGTGGGAAGACTTATGGGATTCATCTATGGAATAAACATAGTAGCAGATTGACAATTGAAGATGGAAGTGTCATTGGAAGACTTATATCAGATTACTGTGAAACACTCTAG

>Glyma03g09050.2   sequence type=predicted peptide   gene model=Glyma03g09050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFCISSFQLQLSPDTIIQKLFVHRLLKHAKLSVFPLITFSAIIFLIYADSIIYHDSLHSATNKEATEKLEVHNHRTKEEIRSTLVLIPLHSIREKDEADSQKQKALVTPLNVTEEERQTCLFGGRELLPVESIFKNHPKACLTILSRTLDTKHGYRILKPLLDRRFKVQAMAPDLPFLVKGTPVEAWFRELRKGRKDPSEIPLSQNLSNLIRLAVLYKYGGVYIDTYFILYSKHWTRLNNAVLIFDIGHPLRHRFINEFALTFNGNKWGNNGPYLVSRVIKRLFKRHDFNFTILPPMAFYPVDWNKIKSRRVEANLLQLSGKTYGIHLWNKHSSRLTIEDGSVIGRLISDYCETL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo