Report for Sequence Feature Glyma07g02001
Feature Type: gene_model
Chromosome: Gm07
Start: 1394877
stop: 1396357
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g02001
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G11590 AT
Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr5:3727789-3728499 REVERSE LENGTH=236
SoyBase E_val: 2.00E-58 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0045893 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
PF00847 PFAM
AP2 domain
JGI ISS
UniRef100_B4UW60 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: DREB-like protein n=1 Tax=Arachis hypogaea RepID=B4UW60_ARAHY
SoyBase E_val: 6.00E-65 ISS
UniRef100_UPI0002337F02 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0002337F02 related cluster n=1 Tax=unknown RepID=UPI0002337F02
SoyBase E_val: 4.00E-149 ISS
Expression Patterns of Glyma07g02001
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g02001
Paralog Evidence Comments
Glyma08g21650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g02001 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g017300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g02001
Coding sequences of Glyma07g02001
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g02001.1 sequence type=CDS gene model=Glyma07g02001 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACACAACAAACAACAACCTCTTCCTCCTCACATTCGGGCCCAAGGGCCCAGGCCCAGAAACAGAGCAAGAGGCCCAGGGACTGCAGCAAGCACCCGGTGTACCACGGCGTGCGGAAGCGGAACTGGGGCAAATGGGTGTCCGAAATCCGGGAGCCACGCAAGAAGTCCCGAATCTGGCTCGGAACATTCTCCACTCCCGAAATGGCGGCGCGAGCCCACGACGTGGCGGCCCTCACCATCAAGGGCCAGTCAGCAATCCTCAACTTCCCCGAAATTGCAGACCTGCTCCCTAGGCCCGTCACGTGCTCCCCACGTGACATCCAGACCGCGGCCACGGCCGCGGCCTCCATGGTTAAGTTCGACCCTGTGACACAATCCTCAGACTCGGAGACTCCAGAGTCTTCGGAGCTGAGCGAGATTGTCGAACTTCCCAACATTGAAGACAGCAGCGTTGACTCGACACCGGAGTTCGTCTTGGTCGATGTTGTTGACAGTTGGGTGTTTCCCCCAATGGGAATGGGTTCAGAGGGAATCGAGTTCTGTGCCGCTTTTTCTGATGAGTTATTTCCGCAACAGAGTTTTATTGGTTCCGAGATAGAGATACTACCCATTTGGGATTGA
Predicted protein sequences of Glyma07g02001
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g02001.1 sequence type=predicted peptide gene model=Glyma07g02001 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTQQTTTSSSSHSGPRAQAQKQSKRPRDCSKHPVYHGVRKRNWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALTIKGQSAILNFPEIADLLPRPVTCSPRDIQTAATAAASMVKFDPVTQSSDSETPESSELSEIVELPNIEDSSVDSTPEFVLVDVVDSWVFPPMGMGSEGIEFCAAFSDELFPQQSFIGSEIEILPIWD*