Report for Sequence Feature Glyma07g15737
Feature Type: gene_model
Chromosome: Gm07
Start: 15461658
stop: 15465737
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g15737
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
PTHR21562 Panther
NOTUM-RELATED
JGI ISS
PTHR21562:SF1 Panther
PECTIN ACETYLESTERASE
JGI ISS
PF03283 PFAM
Pectinacetylesterase
JGI ISS
UniRef100_G7L4F5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Notum-like protein n=1 Tax=Medicago truncatula RepID=G7L4F5_MEDTR
SoyBase E_val: 1.00E-18 ISS
UniRef100_I1KJY0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KJY0_SOYBN
SoyBase E_val: 4.00E-60 ISS
Expression Patterns of Glyma07g15737
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g15737
Paralog Evidence Comments
Glyma18g39570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g15737 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g131300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g15737
Coding sequences of Glyma07g15737
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g15737.1 sequence type=CDS gene model=Glyma07g15737 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCCTTCATCGTCTTCGTCTTCTTCTTCTTCTTCCGCTCTAACCGTTCCCAATTTGCATCTTCGCGCCCTCAGAATTTGGTCCTCCAAGTACTACGCAATCGCCGCATTCATCTTCCTCGTCCTCTTCTCTCTCCTTCTCTTCTCCCACTTGGATTCACGTTCCCGTTACTCCAACCTCATTCCGTTAACCCTCCTCCGCAACGCCAACCAAACGCTTGCGCTATGCTTGGACGGGAGCGCCCCTGGTTACCATTTCCGAAGCCGGTTCGGATCCGGATCCCGCAATTGGCTGATCCACATTGGGGTTTCTGGCTCCCTTGTTGTTAAAAATGAGTTTGGTTTCTAA
Predicted protein sequences of Glyma07g15737
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g15737.1 sequence type=predicted peptide gene model=Glyma07g15737 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MPSSSSSSSSSSALTVPNLHLRALRIWSSKYYAIAAFIFLVLFSLLLFSHLDSRSRYSNLIPLTLLRNANQTLALCLDGSAPGYHFRSRFGSGSRNWLIHIGVSGSLVVKNEFGF*