Report for Sequence Feature Glyma07g16690
Feature Type: gene_model
Chromosome: Gm07
Start: 16372117
stop: 16376639
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g16690
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G52240 AT
Annotation by Michelle Graham. TAIR10: RHO guanyl-nucleotide exchange factor 11 | chr1:19458844-19459235 REVERSE LENGTH=94
SoyBase E_val: 1.00E-27 ISS
GO:0000226 GO-bp
Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization
SoyBase N/A ISS
GO:0007017 GO-bp
Annotation by Michelle Graham. GO Biological Process: microtubule-based process
SoyBase N/A ISS
GO:0009860 GO-bp
Annotation by Michelle Graham. GO Biological Process: pollen tube growth
SoyBase N/A ISS
GO:0048364 GO-bp
Annotation by Michelle Graham. GO Biological Process: root development
SoyBase N/A ISS
GO:0080147 GO-bp
Annotation by Michelle Graham. GO Biological Process: root hair cell development
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005875 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: microtubule associated complex
SoyBase N/A ISS
GO:0005089 GO-mf
Annotation by Michelle Graham. GO Molecular Function: Rho guanyl-nucleotide exchange factor activity
SoyBase N/A ISS
KOG3430
KOG
Dynein light chain type 1
JGI ISS
PTHR11886 Panther
DYNEIN LIGHT CHAIN
JGI ISS
PTHR11886:SF22 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF01221 PFAM
Dynein light chain type 1
JGI ISS
UniRef100_B9SV39 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cytoplasmic dynein light chain, putative n=1 Tax=Ricinus communis RepID=B9SV39_RICCO
SoyBase E_val: 6.00E-29 ISS
UniRef100_I1KK47 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KK47_SOYBN
SoyBase E_val: 5.00E-78 ISS
Expression Patterns of Glyma07g16690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma07g16690 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g138900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g16690
Coding sequences of Glyma07g16690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g16690.2 sequence type=CDS gene model=Glyma07g16690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTGGAAGGAAAAGCTGTGGTGAGAGAGACAGACATGCCAGAGGGAATGCAGAGCTATGTTATGGAATTAGCACACCAAGCTCTCGATGCACATGAAGTTTCTGATTGTCAGTCCATTGCTCATTTCATCAAACAGAAACTTGATGAAGCATATGGACCTGCTTGGAATTCCGTGGTTGGAAAAGACTTTGGATCTTGCATCACACATTTATGTGGAAGTTTCATATTCTTTCGTGTGGAGATGATGGAATTTCTGATCTTCAAAGATGGGAAGAATTTCACAGAAAGCAGGGAAGAAGCTATTGGAGTGCTGCAGAAGGCTAGAAATTGTGATTAG
Predicted protein sequences of Glyma07g16690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g16690.2 sequence type=predicted peptide gene model=Glyma07g16690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLEGKAVVRETDMPEGMQSYVMELAHQALDAHEVSDCQSIAHFIKQKLDEAYGPAWNSVVGKDFGSCITHLCGSFIFFRVEMMEFLIFKDGKNFTESREEAIGVLQKARNCD*