SoyBase NEW SoyBase for review!
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g44640

Feature Type:gene_model
Chromosome:Gm08
Start:44213968
stop:44216310
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18990AT Annotation by Michelle Graham. TAIR10: AP2/B3-like transcriptional factor family protein | chr3:6549077-6551568 REVERSE LENGTH=341 SoyBaseE_val: 2.00E-33ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleoplasm SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PF02362PFAM B3 DNA binding domain JGI ISS
UniRef100_G7J3B6UniRef Annotation by Michelle Graham. Most informative UniRef hit: B3 domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J3B6_MEDTR SoyBaseE_val: 3.00E-48ISS
UniRef100_I1KYP5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYP5_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g339200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g44640.1   sequence type=CDS   gene model=Glyma08g44640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTTCAAAACTCAACCATAGAGATGATGGCTCTAATGGGGATAGTGCATCAAAGCCAATCCACTTTTTGAGGATCATGCACCCTGACAATCTTCTGCAAGGAAAGCTAAGGCTTCCAGCAGAGTTTGTAAACAAATATGGAAAACACTTATCCAACACAATGTTTCTTAAGCTTCCAAACGGTGCAGAATGGAGAGTAAATTTGGAGAAACGTGATGGTAGAGTTTGGTTTCAAGAAGGTTGGAAAAAGTTTGTGGAGCATCACTCCCTTGCACATGGGCACCTATTGGTTTTCAAATATGATGGAACATTCCATTTTCATGTACTCATCTTTGATCCTAGTGCCAATGAAATAGACTACCCTGTTAACAAAGCAAATCACAAAAGGGTCAGAATTAGTAGTGAAGAAATTCAACCTCCCACGACGTGCAAAACAAGTGGAAATAAGAGGAGTAATTCCAATTTGCAGGACAATGCCTTTCATCAGAAAGTCAGAGACCACAAAGGTAGGTACGAAAGTCCAAGTGAAGGGAAAAGAAACATGGAAGCTGCTGGGAGTATTTCCTTCACAGTGAGAATGAAATCAAGCTCTAAGCAGCACATGTATCTTCCAAAGGACTCACTGAAGGGATACATCAAAGGTGGTGAACAATATGTCAAGCTTCTGGTTGGGGAGAGATCATGGAGGGTTAAATTGGTCCATTACAAAAATCGATCTTCATGTTTCTTTAGTGCAAATTGGCCAGCTTTTGCAAGGGAAAACGATTTAAAAGAAGGAGATGCTTGCTGGTTCCAACTCCTAAACAGTAGTGATGACATAGTGATGAATGTTACCATTTCTAGAGAGGGACACTAA

>Glyma08g44640.1   sequence type=predicted peptide   gene model=Glyma08g44640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSKLNHRDDGSNGDSASKPIHFLRIMHPDNLLQGKLRLPAEFVNKYGKHLSNTMFLKLPNGAEWRVNLEKRDGRVWFQEGWKKFVEHHSLAHGHLLVFKYDGTFHFHVLIFDPSANEIDYPVNKANHKRVRISSEEIQPPTTCKTSGNKRSNSNLQDNAFHQKVRDHKGRYESPSEGKRNMEAAGSISFTVRMKSSSKQHMYLPKDSLKGYIKGGEQYVKLLVGERSWRVKLVHYKNRSSCFFSANWPAFARENDLKEGDACWFQLLNSSDDIVMNVTISREGH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo