SoyBase NEW SoyBase for review!
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g21291

Feature Type:gene_model
Chromosome:Gm09
Start:26255888
stop:26258518
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g21291
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57000AT Annotation by Michelle Graham. TAIR10: nucleolar essential protein-related | chr3:21092610-21094109 FORWARD LENGTH=298 SoyBaseE_val: 7.00E-36ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
PTHR12636Panther NEP1 JGI ISS
PTHR12636:SF2Panther UNCHARACTERIZED JGI ISS
PF03587PFAM EMG1/NEP1 methyltransferase JGI ISS
UniRef100_B9SZX7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nucleolar essential protein, putative n=1 Tax=Ricinus communis RepID=B9SZX7_RICCO SoyBaseE_val: 1.00E-34ISS
UniRef100_UPI0002338155UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338155 related cluster n=1 Tax=unknown RepID=UPI0002338155 SoyBaseE_val: 9.00E-81ISS

Expression Patterns of Glyma09g21291
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g21291 not represented in the dataset
Glyma09g21291 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g21291 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g120100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g21291
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g21291
>Glyma09g21291.1   sequence type=CDS   gene model=Glyma09g21291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGGGGCAATATACGTTAAAATGGATCAACGAGGAGTGTTTGAAGTCAAACCACATGTTCGTATACCAAGAACGTGTAATCGATTCTGTGGTGTCATAATTCTTCTTCGTGTTGTTGAGGAACCTATAACACGCCATTTGCCTGTCAACTCTCACATAGTAGGTCTCTCTTATACTTCAGAAAAGTTGGTTGACATAGAGGAATATGTCTCAGTTTGGAGCAATGATTTGAGTCCTGTTTTTGTGGTAGGCACAATGGTGAATGGGAAAGTAAAAGGGGACTATATGCATGATTATATTTCAATTTCTGAATATCCACTTGCTGCTAAATACTGCCTAGGAATGATATGTGAAGCTTTGTAG
Predicted protein sequences of Glyma09g21291
>Glyma09g21291.1   sequence type=predicted peptide   gene model=Glyma09g21291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGAIYVKMDQRGVFEVKPHVRIPRTCNRFCGVIILLRVVEEPITRHLPVNSHIVGLSYTSEKLVDIEEYVSVWSNDLSPVFVVGTMVNGKVKGDYMHDYISISEYPLAAKYCLGMICEAL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo