SoyBase NEW SoyBase for review!
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g02235

Feature Type:gene_model
Chromosome:Gm11
Start:1395204
stop:1399591
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g02235
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G64150AT Annotation by Michelle Graham. TAIR10: Uncharacterized protein family (UPF0016) | chr1:23809047-23812579 REVERSE LENGTH=370 SoyBaseE_val: 5.00E-53ISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
KOG2881 KOG Predicted membrane protein JGI ISS
PTHR12608Panther TRANSMEMBRANE PROTEIN HTP-1 RELATED JGI ISS
PF01169PFAM Uncharacterized protein family UPF0016 JGI ISS
PF03018PFAM Dirigent-like protein JGI ISS
UniRef100_G7KAQ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein n=1 Tax=Medicago truncatula RepID=G7KAQ7_MEDTR SoyBaseE_val: 2.00E-54ISS
UniRef100_UPI000233C858UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C858 related cluster n=1 Tax=unknown RepID=UPI000233C858 SoyBaseE_val: 1.00E-79ISS

Expression Patterns of Glyma11g02235
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g02235 not represented in the dataset
Glyma11g02235 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g02235
ParalogEvidenceComments
Glyma01g43270 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g02235 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma11g02235
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g02235
>Glyma11g02235.1   sequence type=CDS   gene model=Glyma11g02235   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACAAGGGTACCATAAACTTTGCTGGTGCTGATCCTTTGATGAACAATACCAGAGACATTTCGGTTATTGGTGGGACTGGTGACTTTTTCATGGCAAGGGGAGTGGCCACTCTGAGCACGGATGCTTTTTCATGGCACGGGGCTTATCCAAGGCAGGAGCAGAGGAAGGAAGCGTTTCTGCTAATATTTTTCTCTGAACTGGGAGACAAGACCTTTTTCATTGCAGTGTACTTTGGGGTCTCTACCCTGCTGGATGCCTCATCCAGTGATAGCCAAAAATCCGATGAAGAGCAGAAGGAGATAATATTTGAGCTAGCAGTTTCCGATTTTTCTGGAAATGGGGCTGGGATACTATCAGCTGCCAGCACAGTTGCCAGTACTTTTCTCTTGGTTTTTGTTGCTGAATGGGGCGATAAGTCATTTTTCTCCACAATTGCCCTAGCAGCAGCTTCTTCTCCCCTTGGAGTCATAGCTGGAGCACTGGCCGGTCATGGTGTTGCAACTTTGCTAGCTGTACTTGGGGGTTCTTTACTTGGGACGTATTTGTCAGAGAAGGTTATTGCCTACATCGGAGGTGTTCTCTTTCTCGTCTTTGCGGCAATAACCTTATTTGAAATTGTGCAATAG
Predicted protein sequences of Glyma11g02235
>Glyma11g02235.1   sequence type=predicted peptide   gene model=Glyma11g02235   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHKGTINFAGADPLMNNTRDISVIGGTGDFFMARGVATLSTDAFSWHGAYPRQEQRKEAFLLIFFSELGDKTFFIAVYFGVSTLLDASSSDSQKSDEEQKEIIFELAVSDFSGNGAGILSAASTVASTFLLVFVAEWGDKSFFSTIALAAASSPLGVIAGALAGHGVATLLAVLGGSLLGTYLSEKVIAYIGGVLFLVFAAITLFEIVQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo