SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g33741

Feature Type:gene_model
Chromosome:Gm11
Start:35611672
stop:35613711
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g33741
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G70780AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: sperm cell, male gametophyte, pollen tube; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G23150.1); Has 143 Blast hits to 143 proteins in 17 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 143; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink) SoyBaseE_val: 4.00E-38ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1MZE1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MZE1_SOYBN SoyBaseE_val: 1.00E-78ISS
UniRef100_Q2HTL2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated protein, putative n=1 Tax=Medicago truncatula RepID=Q2HTL2_MEDTR SoyBaseE_val: 1.00E-39ISS

Expression Patterns of Glyma11g33741
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g33741 not represented in the dataset
Glyma11g33741 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g33741
ParalogEvidenceComments
Glyma18g04490 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g33741 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g216700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g33741
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g33741
>Glyma11g33741.1   sequence type=CDS   gene model=Glyma11g33741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGATGAAGAAGAGTGGTTTTGAGAAGATGGTGATGTTGCAGAAGAACAACAAGAACAAGGGAAGCTATGATGATGAGAAACCAAGGAGTAAGAGGTTTTTGGTGAACATCAATATCATGGGGAGTGCAGGGCCTATTAGGTTTGTGGTGAATGAGAAAGAGCTTGTTTCTGGGGTCATTGATACTGCTCTCAAATCTTATTCCCGTGAAGGGAGGCTTCCTGTTCTTGGTTTTGATGCCACCAATTTCCTTCTTTACTGTGCTAATGCTGGCTTTGATGCTTTGAGTCCATTGGAACCGATAGGATCTTTTGGAGTGAGGAATTTTGTGCTATGCAAAAAACAGGTGTACTCATCTTCAAAGGCAGCACCACAATCTGAGTTGGCGTCTCACAAGAGCAGTGGTGGCCATGGATGGAAGGCATGGTTGAATAAATCATTTGGTTTAAAAATCGTATCCCATTGA
Predicted protein sequences of Glyma11g33741
>Glyma11g33741.1   sequence type=predicted peptide   gene model=Glyma11g33741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMMKKSGFEKMVMLQKNNKNKGSYDDEKPRSKRFLVNINIMGSAGPIRFVVNEKELVSGVIDTALKSYSREGRLPVLGFDATNFLLYCANAGFDALSPLEPIGSFGVRNFVLCKKQVYSSSKAAPQSELASHKSSGGHGWKAWLNKSFGLKIVSH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo