Report for Sequence Feature Glyma12g31336
Feature Type: gene_model
Chromosome: Gm12
Start: 34928560
stop: 34929490
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma12g31336
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I2FFU6 UniRef
Annotation by Michelle Graham. Best UniRef hit: CLAVATA3 protein n=1 Tax=Lotus japonicus RepID=I2FFU6_LOTJA
SoyBase E_val: 2.00E-24 ISS
UniRef100_I2FFU6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: CLAVATA3 protein n=1 Tax=Lotus japonicus RepID=I2FFU6_LOTJA
SoyBase E_val: 2.00E-24 ISS
Expression Patterns of Glyma12g31336
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma12g31336
Paralog Evidence Comments
Glyma13g38975 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma12g31336 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.12g187800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma12g31336
Coding sequences of Glyma12g31336
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma12g31336.1 sequence type=CDS gene model=Glyma12g31336 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGTCAAAGTTTATCTTTACCACTGTGGTTTTACTTATGCTTTTGTGCTTGCTTCTGATGAGGGAGCCTTCTGGTTGCGGTTCTGCGTATGAATGCTTTGGTGCTAATGCAGCTGATCTAAGGGACATTCCAAACAGGAAGGTGCTGTCTGTTTTGAAGGATAAGAAAACTAGTGCTCTGAAGGCTAGTCTGCAAGGATCATCAAGCAACAAGTATGGTGAAAAGCCACTGAATTGGGAGTTAAGGAAGGTTCCTTCTGGTCCAGATCCGCTGCATCATAATGGTGTCAACCCCAAAAAGCCTCAAACCCCTTAA
Predicted protein sequences of Glyma12g31336
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma12g31336.1 sequence type=predicted peptide gene model=Glyma12g31336 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASKFIFTTVVLLMLLCLLLMREPSGCGSAYECFGANAADLRDIPNRKVLSVLKDKKTSALKASLQGSSSNKYGEKPLNWELRKVPSGPDPLHHNGVNPKKPQTP*