Glyma14g05610 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g05610

Feature Type:	gene_model
Chromosome:	Gm14
Start:	4036764
stop:	4038072
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g05610

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G05030	AT	Annotation by Michelle Graham. TAIR10: Copper transport protein family \| chr4:2576790-2577974 REVERSE LENGTH=110	SoyBase	E_val: 9.00E-18	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
KOG1603	KOG	Copper chaperone	JGI		ISS
PTHR22814	Panther	COPPER TRANSPORT PROTEIN ATOX1-RELATED	JGI		ISS
PTHR22814:SF5	Panther	UNCHARACTERIZED	JGI		ISS
PF00403	PFAM	Heavy-metal-associated domain	JGI		ISS
UniRef100_B9T469	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Metal ion binding protein, putative n=1 Tax=Ricinus communis RepID=B9T469_RICCO	SoyBase	E_val: 6.00E-22	ISS
UniRef100_I1M7K5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M7K5_SOYBN	SoyBase	E_val: 4.00E-89	ISS

Expression Patterns of Glyma14g05610

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g05610 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g051600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g05610

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g05610

Limit To All Plant Sequences

>Glyma14g05610.1   sequence type=CDS   gene model=Glyma14g05610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAAATAGTTATCCAGGTGCACATGGAGAATGACAAATGCAGAAGCAAGGCACTGAAAATTGCTGCAGCCTCTCAAGGTGTGCATTCAGTGGCATTAGAAGGTGAAAGCAGAGATCAAGTGGTGGTGACTGGAGATACAATCGATTCTGTTTGCTTGACGAATAAGTTTCGAAAAAAGTTCAGCAATGCTACCCTTATAAGTGTTGCAGATGCAAACGCTTCCGATGAGCAACAGGGTGGTGGTGGAGGAGAACAGAAAGTTGAAACAACTTTAGAGAAAAAATTGCCAATAGCTTATTGTTATGCTAACTTTCCTCCACCTTGTCCATTATATGTGGTAGATCATGATCCATACCCCAATACTTGCTCTATTCTCTAA

Predicted protein sequences of Glyma14g05610

Limit To All Plant Sequences

>Glyma14g05610.1   sequence type=predicted peptide   gene model=Glyma14g05610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKIVIQVHMENDKCRSKALKIAAASQGVHSVALEGESRDQVVVTGDTIDSVCLTNKFRKKFSNATLISVADANASDEQQGGGGGEQKVETTLEKKLPIAYCYANFPPPCPLYVVDHDPYPNTCSIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain