SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma14g26690

Feature Type:gene_model
Chromosome:Gm14
Start:32741874
stop:32751571
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G43890AT Annotation by Michelle Graham. TAIR10: RAB GTPASE HOMOLOG B18 | chr1:16646934-16648395 FORWARD LENGTH=212 SoyBaseE_val: 7.00E-130ISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0080 KOG GTPase Rab18, small G protein superfamily JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF482Panther JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_B9S2N7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein phosphatase 2c, putative n=1 Tax=Ricinus communis RepID=B9S2N7_RICCO SoyBaseE_val: 5.00E-129ISS
UniRef100_C6TJB7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJB7_SOYBN SoyBaseE_val: 6.00E-154ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g09260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g118400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g26690.1   sequence type=CDS   gene model=Glyma14g26690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGCTTCATCTTCCTCGTCGAGTCAACCTGAATTCGATTACTTGTTCAAGCTTCTCTTGATTGGGGATTCTGGGGTTGGCAAAAGCACCCTGCTTTTGAGCTTCACCTCCGATACCTTCGAGGATCTTTCTCCCACCATCGGTGTAGATTTCAAAGTTAAATATGTTACAATTGGAGGGAAAAAGTTAAAACTTGCTATTTGGGACACAGCTGGGCAGGAAAGGTTTAGAACACTTACTAGTTCATATTACAGAGGAGCACAAGGAATAATTATGGTATATGATGTAACAAGGCGGGAAACCTTTACAAATCTATCTGATATATGGGCTAAAGAAATTGACTTATACTCAACAAATCAAGATTGCATCAAGATGCTTGTTGGAAACAAAGTTGATAAGGAAAGTGAAAGGGTTGTCAGCAAAAAGGAAGGAATAGACTTTGCTAGGGAATATGGTTGTCTGTATACTGAATGCAGTGCAAAAACCAGAGTCAATGTTACACAGTGTTTTGATGAGCTTGTGATGAAGATTTTGGAGACACCAAGCCTCTTGGCTGAGGGCTCATCTGGTGTGAAAAAGAACATCTTCAAGCAGAAACCCCCACTGTCTGATGCATCAAGTAGTGGCTGCTGCTCATGGTAA

>Glyma14g26690.1   sequence type=predicted peptide   gene model=Glyma14g26690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDASSSSSSQPEFDYLFKLLLIGDSGVGKSTLLLSFTSDTFEDLSPTIGVDFKVKYVTIGGKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRETFTNLSDIWAKEIDLYSTNQDCIKMLVGNKVDKESERVVSKKEGIDFAREYGCLYTECSAKTRVNVTQCFDELVMKILETPSLLAEGSSGVKKNIFKQKPPLSDASSSGCCSW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo