Report for Sequence Feature Glyma18g01340
Feature Type: gene_model
Chromosome: Gm18
Start: 701671
stop: 703255
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g01340
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G48140 AT
Annotation by Michelle Graham. TAIR10: B12D protein | chr3:17778471-17779299 FORWARD LENGTH=88
SoyBase E_val: 5.00E-43 ISS
GO:0010150 GO-bp
Annotation by Michelle Graham. GO Biological Process: leaf senescence
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005777 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: peroxisome
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF06522 PFAM
B12D protein
JGI ISS
UniRef100_G7J2H3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: B12D protein n=1 Tax=Medicago truncatula RepID=G7J2H3_MEDTR
SoyBase E_val: 3.00E-45 ISS
UniRef100_I1MYJ0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MYJ0_SOYBN
SoyBase E_val: 2.00E-59 ISS
Expression Patterns of Glyma18g01340
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g01340
Paralog Evidence Comments
Glyma11g37370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g01340 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g009800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g01340
Coding sequences of Glyma18g01340
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g01340.2 sequence type=CDS gene model=Glyma18g01340 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCGCCAACAGATGGTTAAAACCTGAGGTATACCCACTGTTCGCTGCAGTTGGTGTGGCTGTTGGGATCTGCGGTATGCAACTTGTCAGGAATATAACCACCAATCCTGAAGTCAGGGTGACCAAACAGAACAGAGCTGCAGGAATTCTTGAGAATTTTGCAGAGGGAGAGAAATATTCACAACATAGCCTGAGGAAGTATGTCCGCGGCAAACAACCTCAGATTATGCCATCCGTCAACAACTTCTTCTCTGATCCATCAAACTAA
Predicted protein sequences of Glyma18g01340
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g01340.2 sequence type=predicted peptide gene model=Glyma18g01340 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAANRWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKYSQHSLRKYVRGKQPQIMPSVNNFFSDPSN*