SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.08g019900

Feature Type:gene_model
Chromosome:Gm08
Start:1632985
stop:1633986
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G23690.1AT Disease resistance-responsive (dirigent-like protein) family protein JGI N/AIEA
GO:0005576GO-cc extracellular region EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0048046GO-cc apoplast EnsemblGenomesN/AIEA
GO:0016853GO-mf isomerase activity EnsemblGenomesN/AIEA
PTHR21495Panther NUCLEOPORIN-RELATED JGI N/AIEA
PTHR21495:SF5Panther JGI N/AIEA
PF03018PFAM Dirigent-like protein JGI N/AIEA
PWY-5466SoyCyc9 matairesinol biosynthesis Plant Metabolic Network ISS
PWY-6824SoyCyc9 justicidin B biosynthesis Plant Metabolic Network ISS
GN7V-50669SoyCyc9-rxn dirigent protein Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.05g213400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma08g02330 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.08g019900.1 sequence-type=CDS polypeptide=Glyma.08g019900.1.p locus=Glyma.08g019900 ID=Glyma.08g019900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAGTTGTTCAGTTTAAACTTGAAAGTCTTGACACGAATATATTTAATTAATGGTAACTTTAGTGTATCCGTGAAGTCTAGACTGCTTATAAAATCCAATTTCGTGACACACATTATTGAGCTAGCCAGCCAAGTAATATTCAATAAAAATATGGAACTGACGAGGCTCATTTCGGTTCTCTTCTTCTTGCTAGTGATCACGGTGGGATCTTCTGCTTCTCCACAGCATTGGAGAAAAAAAAGGGTTCGCGAGCCGTGCAAGAAGTTGGTGTTTTATTTCCACGACATAATTTACAACGGCCACAATTCCAAGAATGCCACTTCCGCAATTGTTGGAACACCCGCATGGGGAAACAGGACCATACTAGCGGGGCAGAACCACTTCGGTGACTTGGTTGTGTTCGATGACCCCATCACCTTGGACAACAACTTGCACTCGCCACCGGTTGGACGTGCCCAAGGGTTTTACGTTTACGATAAGAAGGAGATTTTCACCGCTTGGCTTGGCTTCTCTTTTGTCTTCAACTCTACCCACCATAGAGGTAGCATTAACTTCGCTGGTGCTGACCCTTTGATGAATAAGACCAGGGACATTTCGGTAATTGGAGGGACAGGTGACTTCTTCATGACTAGGGGTGTCGCCACTCTCTCCACGGATGCATTTGAAGGGGAAGTTTATTTCAGGCTTCGTGCGGATATTAACTTGTTCGAATGTTGGTGA

>Glyma.08g019900.1.p sequence-type=predicted peptide transcript=Glyma.08g019900.1 locus=Glyma.08g019900 ID=Glyma.08g019900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKLFSLNLKVLTRIYLINGNFSVSVKSRLLIKSNFVTHIIELASQVIFNKNMELTRLISVLFFLLVITVGSSASPQHWRKKRVREPCKKLVFYFHDIIYNGHNSKNATSAIVGTPAWGNRTILAGQNHFGDLVVFDDPITLDNNLHSPPVGRAQGFYVYDKKEIFTAWLGFSFVFNSTHHRGSINFAGADPLMNKTRDISVIGGTGDFFMTRGVATLSTDAFEGEVYFRLRADINLFECW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo