SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.08g207900

Feature Type:gene_model
Chromosome:Gm08
Start:16813400
stop:16817850
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.08g207900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15540.1AT indole-3-acetic acid inducible 19 JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0009734GO-bp auxin-activated signaling pathway EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus JGI N/AIEA
GO:0005515GO-mf protein binding EnsemblGenomesN/AIEA
PF02309PFAM AUX/IAA family JGI N/AIEA

Proteins Associated with Glyma.08g207900
LocusGene SymbolProtein Name
Aux22 Auxin-regulated protein 22
AUX22 auxin-regulated protein (Aux22)
IAA27 Indole-3-Acetic Acid Responsive Gene 27

Expression Patterns of Glyma.08g207900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.08g207900
ParalogEvidenceComments
Glyma.07g034200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.08g207900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma08g22190 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.08g207900
>Glyma.08g207900.1 sequence-type=CDS polypeptide=Glyma.08g207900.1.p locus=Glyma.08g207900 ID=Glyma.08g207900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCCAAAGAAGGTCTTGGACTTGAAATCACTGAGCTAAGGTTGGGTCTACCTGATGCGGAGCATCAAGTAAGTGTAGTCAATAAGAAAAATGAGAAGAAGAGGGCATTCTCGGAAATTGATGATGGTGTTGGAGATGAAAATAGCTCCTCCGGCGGAGGCGACCGGAAAATGGAGACGAATAAGAGTCAAGTGGTGGGGTGGCCTCCGGTGTGCTCTTACCGGAAGAAGAACAGCATGAACGAAGGTGCTTCAAAGATGTACGTGAAGGTTAGCATGGACGGTGCTCCTTTCTTGCGTAAAATTGATTTGGGTCTGCATAAGGGCTACTCAGATTTAGCTTTGGCTTTGGACAAGCTCTTTGGTTGCTATGGAATGGTGGAGGCGTTGAAAAATGCAGACAATTCTGAACACGTTCCCATTTATGAGGACAAAGATGGTGATTGGATGCTTGTTGGAGATGTCCCTTGGGAAATGTTTATGGAGTCATGCAAGAGGCTGAGGATTATGAAGAAATCAGATGCGAAGGGCTTCGGTTTGCAACCAAAAGGATCTTTAAAGGGATTCATAGAAAGCGCGGCAAAGTGA
Predicted protein sequences of Glyma.08g207900
>Glyma.08g207900.1.p sequence-type=predicted peptide transcript=Glyma.08g207900.1 locus=Glyma.08g207900 ID=Glyma.08g207900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAKEGLGLEITELRLGLPDAEHQVSVVNKKNEKKRAFSEIDDGVGDENSSSGGGDRKMETNKSQVVGWPPVCSYRKKNSMNEGASKMYVKVSMDGAPFLRKIDLGLHKGYSDLALALDKLFGCYGMVEALKNADNSEHVPIYEDKDGDWMLVGDVPWEMFMESCKRLRIMKKSDAKGFGLQPKGSLKGFIESAAK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo