SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.09g226500

Feature Type:gene_model
Chromosome:Gm09
Start:45136253
stop:45137166
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.09g226500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G28420.1AT Lactoylglutathione lyase / glyoxalase I family protein JGI N/AIEA
KOG2944 KOG Glyoxalase JGI N/AIEA
PTHR10374Panther LACTOYLGLUTATHIONE LYASE (GLYOXALASE I) JGI N/AIEA
PTHR10374:SF0Panther JGI N/AIEA
PF00903PFAM Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily JGI N/AIEA

Proteins Associated with Glyma.09g226500
LocusGene SymbolProtein Name
GLYI-12 Glyoxylase 1 gene 12

Expression Patterns of Glyma.09g226500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.09g226500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma09g36060 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.09g226500
>Glyma.09g226500.1 sequence-type=CDS polypeptide=Glyma.09g226500.1.p locus=Glyma.09g226500 ID=Glyma.09g226500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
AAGGAAGGAAAAGGAAAGGAGGAAAACCCACCTCCATTATTGGCAATGAACCACGTTTCAAGGTTGTGTAGGAATGTGAAGGAATCCATAGATTTCTACACAAAGGTGCTGGGATTTGTTCTGATTGAGAGGCCCCAAGCTTTGGACTTTGAGGGTGCATGGTTGTTCAATTATGGAGTTGGTATCCACTTGTGTGAAGATCTGGAAGCAATGGAGAAAAAGTTGAAGGAGAAGAATGTGAAGTACATGAAAAGGACTCTGGAGAGAGAAGATGGAACGACAATGGATCAAATTTTCTTCAATGACCCAGATGGGTTCATGGTGGAGATATGA
Predicted protein sequences of Glyma.09g226500
>Glyma.09g226500.1.p sequence-type=predicted peptide transcript=Glyma.09g226500.1 locus=Glyma.09g226500 ID=Glyma.09g226500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
KEGKGKEENPPPLLAMNHVSRLCRNVKESIDFYTKVLGFVLIERPQALDFEGAWLFNYGVGIHLCEDLEAMEKKLKEKNVKYMKRTLEREDGTTMDQIFFNDPDGFMVEI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo