Report for Sequence Feature Glyma.10G177000
Feature Type: gene_model
Chromosome: Gm10
Start: 41048590
stop: 41050344
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.10G177000
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G10300.1 AT
RmlC-like cupins superfamily protein
JGI N/A IEA
PF05899 PFAM
Protein of unknown function (DUF861)
JGI N/A IEA
Expression Patterns of Glyma.10G177000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.10G177000
Paralog Evidence Comments
Glyma.20g213200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.10G177000 Gene Call Version Wm82.a2.v1
Coding sequences of Glyma.10G177000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.10g177000.1 sequence-type=CDS polypeptide=Glyma.10g177000.1.p locus=Glyma.10g177000 ID=Glyma.10g177000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCATCATCATTTGTGGGCACTTTATTACCCAACAAGTTCACACAAAACAAACACTTATCATCTGTTCCTGCAAGTAGAGGTGCTCCAACAAGGAGAAGAGTACACTTAGCAACAACAAGAGCAGAGAGCATGACTACTGTCATAGAAAAACTTGGCATCAAGATTGAGAGGAACCCTCCTGAGTCCAAGCTCACTCAACTGGGTGTTAGGCAATGGCCCAAATGGGGTTGCCCTCCAAGCAAGTTCCCATGGACATATGAAGCCAAAGAGACTTGCTATCTTCTGGAAGGAAAAGTGAAGGTCTTTCCTAGTGGGTCAAATGAGTCAGTTGAAATTGCTGCTGGTGACTTGGTTGTGTTTCCCAAAGGGATGAGTTGCACTTGGGATGTGTCTGTTGGTGTAGACAAGCACTATAATTTTGAATAA
Predicted protein sequences of Glyma.10G177000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.10g177000.1.p sequence-type=predicted peptide transcript=Glyma.10g177000.1 locus=Glyma.10g177000 ID=Glyma.10g177000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASSFVGTLLPNKFTQNKHLSSVPASRGAPTRRRVHLATTRAESMTTVIEKLGIKIERNPPESKLTQLGVRQWPKWGCPPSKFPWTYEAKETCYLLEGKVKVFPSGSNESVEIAAGDLVVFPKGMSCTWDVSVGVDKHYNFE*