SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.13g082300

Feature Type:gene_model
Chromosome:Gm13
Start:19154278
stop:19159357
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08640.1AT flavonol synthase 1 JGI N/AIEA
GO:0051555GO-bp flavonol biosynthetic process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity JGI N/AIEA
GO:0016706GO-mf oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors JGI N/AIEA
GO:0045431GO-mf flavonol synthase activity EnsemblGenomesN/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
KOG0143 KOG Iron/ascorbate family oxidoreductases JGI N/AIEA
PTHR10209Panther OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEIN JGI N/AIEA
PTHR10209:SF55Panther JGI N/AIEA
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI N/AIEA
PWY-3101SoyCyc9 flavonol biosynthesis Plant Metabolic Network ISS
PWY-5391SoyCyc9 syringetin biosynthesis Plant Metabolic Network ISS
PWY-6787SoyCyc9 flavonoid biosynthesis (in equisetum) Plant Metabolic Network ISS
GN7V-45071SoyCyc9-rxn flavonol synthase Plant Metabolic Network ISS

LocusGene SymbolProtein Name
Wm FLS1 Flavonol synthase 1

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.14g163300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma13g02740 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.13g082300.1 sequence-type=CDS polypeptide=Glyma.13g082300.1.p locus=Glyma.13g082300 ID=Glyma.13g082300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAGGTGCTAAGGGTGCAAACCATAGCTTCCAAATCCAAAGATGCTGCCATCCCAGCCATGTTTGTTAGGGCAGAGACAGAGCAACCAGGCATCACAACCGTTCAAGGGGTGAACCTTGAGGTGCCAATTATTGATTTTAGTGACCCAGATGAAGGGAAAGTGGTGCATGAGATTTTGGAGGCAAGTAGGGACTGGGGCATGTTCCAAATTGTGAACCATGACATACCTAGTGATGTTATAAGAAAGTTGCAAAGTGTTGGGAAAATGTTCTTTGAGTTGCCACAAGAGGAAAAAGAGTTGATTGCTAAGCCTGCTGGGTCTGATTCTATTGAAGGGTATGGCACAAAGCTTCAGAAAGAGGTGAATGGCAAGAAAGGGTGGGTGGATCATTTGTTCCACATTGTGTGGCCTCCTTCCTCCATCAACTACAGTTTCTGGCCCCAAAACCCCCCTTCTTACAGGGAAGTTAATGAGGAATATTGCAAGCACCTAAGAGGAGTGGTAGACAAATTGTTCAAAAGTATGTCGGTAGGGTTGGGGCTTGAAGAGAATGAGCTAAAGGAGGGTGCAAATGAAGATGACATGCATTATCTTTTAAAAATCAATTATTACCCACCTTGTCCATGTCCTGATCTGGTCTTGGGTGTGCCACCACACACAGACATGTCCTACCTCACAATTCTGGTGCCTAACGAGGTGCAGGGCCTTCAAGCATGTAGGGATGGCCATTGGTACGATGTTAAGTATGTCCCCAATGCCCTCGTTATTCACATTGGCGACCAAATGGAGATACTGAGCAATGGAAAATATAAGGCAGTTTTTCACAGAACAACAGTGAACAAAGATGAGACAAGAATGTCGTGGCCCGTGTTCATAGAACCCAAAAAGGAACAAGAAGTTGGTCCTCACCCAAAGTTGGTTAACCAAGACAATCCACCAAAATACAAAACCAAGAAATACAAGGATTATGCTTATTGTAAGCTCAATAAGATCCCTCAATGA

>Glyma.13g082300.1.p sequence-type=predicted peptide transcript=Glyma.13g082300.1 locus=Glyma.13g082300 ID=Glyma.13g082300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEVLRVQTIASKSKDAAIPAMFVRAETEQPGITTVQGVNLEVPIIDFSDPDEGKVVHEILEASRDWGMFQIVNHDIPSDVIRKLQSVGKMFFELPQEEKELIAKPAGSDSIEGYGTKLQKEVNGKKGWVDHLFHIVWPPSSINYSFWPQNPPSYREVNEEYCKHLRGVVDKLFKSMSVGLGLEENELKEGANEDDMHYLLKINYYPPCPCPDLVLGVPPHTDMSYLTILVPNEVQGLQACRDGHWYDVKYVPNALVIHIGDQMEILSNGKYKAVFHRTTVNKDETRMSWPVFIEPKKEQEVGPHPKLVNQDNPPKYKTKKYKDYAYCKLNKIPQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo