Glyma.19g161100

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.19g161100

Feature Type:	gene_model
Chromosome:	Gm19
Start:	42187796
stop:	42191925
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.19g161100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14550.1	AT	indole-3-acetic acid inducible 14	JGI	N/A	IEA
GO:0006351	GO-bp	transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0006355	GO-bp	regulation of transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0006355	GO-bp	regulation of transcription, DNA-templated	JGI	N/A	IEA
GO:0009734	GO-bp	auxin-activated signaling pathway	EnsemblGenomes	N/A	IEA
GO:0005634	GO-cc	nucleus	EnsemblGenomes	N/A	IEA
GO:0005634	GO-cc	nucleus	JGI	N/A	IEA
GO:0005515	GO-mf	protein binding	EnsemblGenomes	N/A	IEA
PF02309	PFAM	AUX/IAA family	JGI	N/A	IEA

Proteins Associated with Glyma.19g161100

Locus	Gene Symbol	Protein Name
	AUX28	Auxin-regulated protein 28
	IAA56	Indole-3-Acetic Acid Responsive Gene 56

Expression Patterns of Glyma.19g161100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.19g161100

Paralog	Evidence	Comments
Glyma.03g158700	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.19g161100 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma19g34380	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.19g161100

Limit To All Plant Sequences

>Glyma.19g161100.1 sequence-type=CDS polypeptide=Glyma.19g161100.1.p locus=Glyma.19g161100 ID=Glyma.19g161100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAGGTTGGCCTCAAGAAGGAGAACATGGGGTTTGAGGAAACTGAGTTAAGGCTTGGACTGCCTGGAAACGGAGGCACTGAAGAAGTGCTCATCAGGAAGAGGGGTTTCTCTGAGACTGAAACTGGTCATGAAGATGAGTCTGCCACCACTGTGGATTTGATGCTTAATCTTTCTTCTAAGGAGGCCGCAACCACTGCTGCTGCTGCTGCAGATCCAACTGATAAGCACAAGACTTTGCCTAAGGAGAAGACCCTTCTGCCAGCAGATCCTGCTAAGCCTCCAGCCAAGACGCAGGTGGTGGGTTGGCCACCTGTGCGGTCCTTCCGGAAGAACATGTTGGCTGTGCAAAAGAGCGTTGGAGAAGAGAGCGAGAAGAACAGCAGCCCTAATGCAAGCTTTGTCAAAGTTAGCATGGATGGAGCACCTTACCTTCGCAAAGTGGACTTGAAGATGTACAAGAGTTACCGAGAGCTCTCTGATTCTTTAGGCAAAATGTTCAGCTCCTTCACCTTTGGCAATTGTGAATCCCAAGGAATGAAGGATTTCATGAATGAGAGCAAGCTGAATGATCTCTTGAACAGCTCTGATTATGTCCCAACCTATGAGGACAAGGATGGTGACTGGATGCTTGTCGGTGATGTCCCATGGGAGATGTTTGTTGAATCATGCAAGCGTTTACGCATCATGAAAGGAAAGGAGGCTATTGGTCTTGGTCTTGCACCAAGAGCCATGGCAAAATGCAAGAACAGGAGCTAG

Predicted protein sequences of Glyma.19g161100

Limit To All Plant Sequences

>Glyma.19g161100.1.p sequence-type=predicted peptide transcript=Glyma.19g161100.1 locus=Glyma.19g161100 ID=Glyma.19g161100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEVGLKKENMGFEETELRLGLPGNGGTEEVLIRKRGFSETETGHEDESATTVDLMLNLSSKEAATTAAAAADPTDKHKTLPKEKTLLPADPAKPPAKTQVVGWPPVRSFRKNMLAVQKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain