Glyma03g03920 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g03920

Feature Type:	gene_model
Chromosome:	Gm03
Start:	3826814
stop:	3829735
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g03920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G12244	AT	Annotation by Michelle Graham. TAIR10: Polynucleotidyl transferase, ribonuclease H-like superfamily protein \| chr1:4157719-4158893 FORWARD LENGTH=254	SoyBase	E_val: 2.00E-55	ISS
GO:0006139	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process	SoyBase	N/A	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0006310	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA recombination	SoyBase	N/A	ISS
GO:0006974	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
PF03652	PFAM	Uncharacterised protein family (UPF0081)	JGI		ISS
UniRef100_B9SP56	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hydrolase, acting on ester bonds, putative n=1 Tax=Ricinus communis RepID=B9SP56_RICCO	SoyBase	E_val: 2.00E-57	ISS
UniRef100_I1JKV7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JKV7_SOYBN	SoyBase	E_val: 5.00E-114	ISS

Expression Patterns of Glyma03g03920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g03920

Paralog	Evidence	Comments
Glyma01g33052	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g03920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g033200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g03920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g03920

Limit To All Plant Sequences

>Glyma03g03920.1   sequence type=CDS   gene model=Glyma03g03920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAAGTGCTTCCTCTACCACCCCACAAACCGTTTCTTCGTTGTTCACCTTCGAACCCATCCTTTGTAAATGGCAAAAATGGTTATTGCAGAGTAAAGGCATTGACTTTGGATGAACTTCCCCCAAACGCGCTTCGGAAGAAGAGAGAGCCGCAATGGAGAGGAGGCTTCAGCCTCGGACTCGACTTGGGATTGGCTCGCACTGGCCTCGCCCTCAGCAAAGGCTTCTCTATTCGCCCTTTAACCGTTTTGGAACTGCGAGGACAGAAGCTTGAGGTTCAGATTATTAACATTGCCGAAGAAGAGGAGGTTGATGAGTTTATAATTGGACTTCCAAAATCTTCTGATGGGAAGGAAACACCACAGTCGAACAAAGTCCGAAGTGTTGCTGGAAGGCTTGCTGTTCGAGCTGCTGAGAGGGGTTGGAGAGTGTATCTACAGGATGAACATGGGACAACAGAAGAAGCCAAAGATAGAATGATCAACATGTAA

Predicted protein sequences of Glyma03g03920

Limit To All Plant Sequences

>Glyma03g03920.1   sequence type=predicted peptide   gene model=Glyma03g03920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QVLPLPPHKPFLRCSPSNPSFVNGKNGYCRVKALTLDELPPNALRKKREPQWRGGFSLGLDLGLARTGLALSKGFSIRPLTVLELRGQKLEVQIINIAEEEEVDEFIIGLPKSSDGKETPQSNKVRSVAGRLAVRAAERGWRVYLQDEHGTTEEAKDRMINM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain