Glyma04g12040 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g12040

Feature Type:	gene_model
Chromosome:	Gm04
Start:	11005043
stop:	11006047
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g12040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G08570	AT	Annotation by Michelle Graham. TAIR10: Heavy metal transport/detoxification superfamily protein \| chr4:5455123-5455975 REVERSE LENGTH=150	SoyBase	E_val: 4.00E-80	ISS
GO:0030001	GO-bp	Annotation by Michelle Graham. GO Biological Process: metal ion transport	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
KOG1603	KOG	Copper chaperone	JGI		ISS
PTHR22814	Panther	COPPER TRANSPORT PROTEIN ATOX1-RELATED	JGI		ISS
PTHR22814:SF14	Panther	COPPER CHAPERONE-RELATED	JGI		ISS
PF00403	PFAM	Heavy-metal-associated domain	JGI		ISS
UniRef100_I1JVJ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JVJ2_SOYBN	SoyBase	E_val: 6.00E-104	ISS
UniRef100_O81464	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Heavy-metal-associated domain-containing protein n=1 Tax=Arabidopsis thaliana RepID=O81464_ARATH	SoyBase	E_val: 2.00E-77	ISS

Expression Patterns of Glyma04g12040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g12040

Paralog	Evidence	Comments
Glyma06g11190	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g12040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g106500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g12040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g12040

Limit To All Plant Sequences

>Glyma04g12040.1   sequence type=CDS   gene model=Glyma04g12040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGTACAAGGTCCTTTGGAATACTTATCTGACTTACTTAGCACCAAAAAGAAGAAGAAGAAGAAGCAAGTCCAAACTGTAGCACTGAAAATCAGAATGGACTGTGAAGGCTGTGCACGCAAGGTTAAGCATGTCCTTTCTGGTGTTAAAGGAGCTAAGTCGGTGGAAGTGGACTTGAAGCAGCAGAAAGCAACAGTGACAGGATATGTTGAGCCAAAGAAAGTGCTTAAGGCTGCTCAGTCTACTAAAAAGAAGGTTGAACTGTGGCCATATGTTCCGTACACTATGGTGGCTAACCCTTATATATCTCAAGCCTACGATAAGAAGGCTCCTCCTAATATGGTGAGGAAGGTGTCTGACACTACCAACATATCAGAAACCACCGTGGACGACCGTTACATACAGATGTTCAGTGATGAAAACCCAAATGCCTGCTCTATCATGTAA

Predicted protein sequences of Glyma04g12040

Limit To All Plant Sequences

>Glyma04g12040.1   sequence type=predicted peptide   gene model=Glyma04g12040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVQGPLEYLSDLLSTKKKKKKKQVQTVALKIRMDCEGCARKVKHVLSGVKGAKSVEVDLKQQKATVTGYVEPKKVLKAAQSTKKKVELWPYVPYTMVANPYISQAYDKKAPPNMVRKVSDTTNISETTVDDRYIQMFSDENPNACSIM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain