SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g02970

Feature Type:gene_model
Chromosome:Gm08
Start:2051539
stop:2056370
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g02970
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G10810AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G24026.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr4:6645986-6646231 REVERSE LENGTH=81 SoyBaseE_val: 1.00E-10ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1KPN6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KPN6_SOYBN SoyBaseE_val: 6.00E-105ISS

Expression Patterns of Glyma08g02970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g02970
ParalogEvidenceComments
Glyma05g36590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g02970 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g026000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g02970
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g02970
>Glyma08g02970.2   sequence type=CDS   gene model=Glyma08g02970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTATACAATACAACGGGCCGTGACAAAGCAGTTAGGTTTTTCTTTTTTTTGTTTCAAGAATGCAATTAGTAAATCACTAAATCCAGAAGGGGAAAAAAAGAGAGAAAAGAAATCAGGGGTAAACTTTCTCTCTCTCCCTTGCTTATTCCTCCCAAAAGAAAAAGACGGTTTCCGTTGGAAGGAAGAAAGAAAGAAATTGAGTTTGAGATCTGATTGTGCGGCGACGATGGAGAACAACGACAGCATCATATCGCGGGAGAAGATCGACCAGGCAGCGGTGTGGCTCGGCTCCGCCGTCTCTTCCGCTTTCTTTTCCTCATTGGAACGCTTTTCCTGCGTCAACGTCGCCACCTCTGACCCCGACAACGACGATGACGACGACGATTATTACTCCACCACCACCGCCACTCCCACCTCCGCATCCACCACCACCACCACCGCCCTCGCCACCACTCCTCCCTCCGTTCAGGTCAACGGGGAAAAAACAAACGACGACGTCTCCAACCTCCCCGTTTGA
Predicted protein sequences of Glyma08g02970
>Glyma08g02970.2   sequence type=predicted peptide   gene model=Glyma08g02970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDYTIQRAVTKQLGFSFFCFKNAISKSLNPEGEKKREKKSGVNFLSLPCLFLPKEKDGFRWKEERKKLSLRSDCAATMENNDSIISREKIDQAAVWLGSAVSSAFFSSLERFSCVNVATSDPDNDDDDDDYYSTTTATPTSASTTTTTALATTPPSVQVNGEKTNDDVSNLPV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo