SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g12330

Feature Type:gene_model
Chromosome:Gm15
Start:9119743
stop:9120677
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g12330
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16450AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: photorespiration; LOCATED IN: mitochondrion, mitochondrial membrane, mitochondrial respiratory chain complex I, respiratory chain complex I; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15 growth stages. | chr4:9280132-9280541 FORWARD LENGTH=106 SoyBaseE_val: 1.00E-58ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005747GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0031966GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial membrane SoyBaseN/AISS
GO:0045271GO-cc Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF10785PFAM NADH-ubiquinone oxidoreductase 21 kDa subunit JGI ISS
UniRef100_A3BTD8UniRef Annotation by Michelle Graham. Most informative UniRef hit: cDNA clone:J023121F15, full insert sequence n=5 Tax=Oryza RepID=A3BTD8_ORYSJ SoyBaseE_val: 2.00E-58ISS
UniRef100_C6SY14UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SY14_SOYBN SoyBaseE_val: 1.00E-65ISS

Expression Patterns of Glyma15g12330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g12330
ParalogEvidenceComments
Glyma09g01446 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g12330 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g116500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g12330
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g12330
>Glyma15g12330.1   sequence type=CDS   gene model=Glyma15g12330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACACAGACATCACTGCATCGACGAAGCCAGAGTACCCTGTCATTGATCGTAACCCTCCCTTCACCAAAGTCGTCGGCAACTTCAACACCCTCGACTATCTCCGATTCGTCACCATCACCGGCGTTTCTGTCACCGTCGGCTATCTCTCCGGGATTAAGCCTGGAATTAGGGGTCCTTCGATGGTTACAGGGGGCTTGATCGGAGTGATGGGTGGGTTCATGTATGCTTACCAGAACTCCGCTGGTAGACTCATGGGTTTCTTCCCCAACGATGATGAGGTAGCTCGCTACAACAAAAAATAA
Predicted protein sequences of Glyma15g12330
>Glyma15g12330.1   sequence type=predicted peptide   gene model=Glyma15g12330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNTDITASTKPEYPVIDRNPPFTKVVGNFNTLDYLRFVTITGVSVTVGYLSGIKPGIRGPSMVTGGLIGVMGGFMYAYQNSAGRLMGFFPNDDEVARYNKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo