Glyma15g17090 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g17090

Feature Type:	gene_model
Chromosome:	Gm15
Start:	13402839
stop:	13403237
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g17090

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G23230	AT	Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein \| chr3:8289647-8290066 REVERSE LENGTH=139	SoyBase	E_val: 2.00E-40	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_B9HU98	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AP2/ERF domain-containing transcription factor n=1 Tax=Populus trichocarpa RepID=B9HU98_POPTR	SoyBase	E_val: 1.00E-39	ISS
UniRef100_I1MGW5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGW5_SOYBN	SoyBase	E_val: 8.00E-92	ISS

Expression Patterns of Glyma15g17090

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g17090

Paralog	Evidence	Comments
Glyma09g05840	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g17090 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g159100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g17090

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g17090

Limit To All Plant Sequences

>Glyma15g17090.1   sequence type=CDS   gene model=Glyma15g17090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAGGCACATAAGGGGGAGCAAGACAAAGAGAAAGGAGGGGAAGAAGTGAAGTACCGTGGCGTGAGAAGGAGGCCATGGGGTAAGTTCGGAGCAGAGATCAGAGACCCAACAAAATCTACAGGAAGACAATGGTTAGGGACATTTGACACGGCGGAAGAAGCAGCTAGAGCTTATGATCGTGCAGCCATTGAATTGAGGGGTGCTCTTGCAATCCTTAATTTTCCTGATGAGTACTATGCTCATCTCCCTTTTGTATCATCAAACCCTTCTATTTCAAGTAATGGAAGTTCCTATGCTGCACAACAGAAGGAGGTTATTGAGTTTGAGTGTTTGGATAACAAGGTGTTGGAAGACCTTCTTGAGTCCGAAGTGAAAAGAAGGAACGAGGACTAA

Predicted protein sequences of Glyma15g17090

Limit To All Plant Sequences

>Glyma15g17090.1   sequence type=predicted peptide   gene model=Glyma15g17090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEAHKGEQDKEKGGEEVKYRGVRRRPWGKFGAEIRDPTKSTGRQWLGTFDTAEEAARAYDRAAIELRGALAILNFPDEYYAHLPFVSSNPSISSNGSSYAAQQKEVIEFECLDNKVLEDLLESEVKRRNED*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain