Glyma04g04521 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g04521

Feature Type:	gene_model
Chromosome:	Gm04
Start:	3376871
stop:	3380526
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g04521

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G19130	AT	Annotation by Michelle Graham. TAIR10: S-locus lectin protein kinase family protein \| chr2:8293789-8296275 FORWARD LENGTH=828	SoyBase	E_val: 6.00E-19	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0048544	GO-bp	Annotation by Michelle Graham. GO Biological Process: recognition of pollen	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
GO:0030246	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF599	Panther		JGI		ISS
PF01453	PFAM	D-mannose binding lectin	JGI		ISS
UniRef100_G7J0Q3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Brassinosteroid LRR receptor kinase n=1 Tax=Medicago truncatula RepID=G7J0Q3_MEDTR	SoyBase	E_val: 1.00E-83	ISS
UniRef100_UPI0002339BD2	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339BD2 related cluster n=1 Tax=unknown RepID=UPI0002339BD2	SoyBase	E_val: 5.00E-117	ISS

Expression Patterns of Glyma04g04521

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g04521 not represented in the dataset	Glyma04g04521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g04521 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g042600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g04521

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g04521

Limit To All Plant Sequences

>Glyma04g04521.1   sequence type=CDS   gene model=Glyma04g04521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTATAATGTGGTTGATCCTTGTTTCTCTTGTTATATCTCTGCAACTTTCATCTTCAGAATGGAGGACCCGAAAGATGTCATGCTCTCATAAAAAAAATGGCATGTTCTCTGCTGGCTTCTATGCCGTTGGCCAAAACGCATATTCCTTTGCCGTTTGGTTCTCCGAACCCTACGGCCAAACTCGAAACGCAACCGTTGTATGGATGGCGAACCGTGACCAGCCCGTGAACGGCAAGGACTCAAAGATTTCGCTACTTCGCAACGGCAATCTCGCCTTAAACGACGTTGACGAGTCCCTCGTTTGGTACACAAACACCGCTTCACTGTCCTCCTCTGTGCGTCTATTTTTCGACAACACCGGCAACCTCCTTTTGCATGAAACGCAGGCTACTGGTGTCGTTTTGTGGCAAAGCTTTGATTTCCCTACAGATACCCTTTTACCTCAACAAGTGTTCACGAGACACTCGAAACTTGTCTCTTCTAGAAGTGAGACCAACATGTCCTCTGGTTTCTACGCCTTGTTCTTCGACAACGACAACATTTTTCGTCTTCTTTACGATGGCCCTGAAGTTTCTGGCCTTTACTGGCCAGATCCTTGCAGAGTTGCGGTCATGGACACGCTCGACAATTTTAGTTCCTCAGATGATTTACACTTTTTGACATCTGATTACGGCACTCTGATCCAAAGAAGATTGGTCCTTGATCACGATGGAAACATTCGCGTTTATAGTCAGAGACACGGGGGAGTGGGGGGACTCGAAGTTTTTTGCATATTTGTGATTTGGTTTTTTCTGGTGAGAACAAGGGGGCAAAAATATTCGGGTGTAGATGGACGAGTCTATAATCTGGCCATGAGTGGTTTTAGAAAATTCAGTTATTCTCAGCTGAAACAAGCCACCAAAGGGTTTAGTCAAGAGATAGGAAGGGATGCAGGAGGGGTTGTATACAAAGGAGTGTGTTAG

Predicted protein sequences of Glyma04g04521

Limit To All Plant Sequences

>Glyma04g04521.1   sequence type=predicted peptide   gene model=Glyma04g04521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIMWLILVSLVISLQLSSSEWRTRKMSCSHKKNGMFSAGFYAVGQNAYSFAVWFSEPYGQTRNATVVWMANRDQPVNGKDSKISLLRNGNLALNDVDESLVWYTNTASLSSSVRLFFDNTGNLLLHETQATGVVLWQSFDFPTDTLLPQQVFTRHSKLVSSRSETNMSSGFYALFFDNDNIFRLLYDGPEVSGLYWPDPCRVAVMDTLDNFSSSDDLHFLTSDYGTLIQRRLVLDHDGNIRVYSQRHGGVGGLEVFCIFVIWFFLVRTRGQKYSGVDGRVYNLAMSGFRKFSYSQLKQATKGFSQEIGRDAGGVVYKGVC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain